4if4/1/1:B/1:D

Sequences

>4if4-a1-m1-cB (length=208) [Search sequence]

TIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMEDM
DGVEATTQIKKDLPQIKVLMLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSR
GESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIAKGYSNQEIASASHITIKTVKT
HVSNILSKLEVQDRTQAVIYAFQHNLIQ

>4if4-a1-m1-cD (length=208) [Search sequence]

Structure information

PDB ID	4if4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of the Magnesium and beryllofluoride-activated VraR from Staphylococcus aureus
Assembly ID	1
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0
PubMed citation	23650349

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	D
UniProt accession	Q7A2Q1	Q7A2Q1
Species	158878 (Staphylococcus aureus subsp. aureus Mu50)	158878 (Staphylococcus aureus subsp. aureus Mu50)
Function annotation	BioLiP:4if4B	BioLiP:4if4D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4if4-a1-m1-cB_4if4-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4if4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4if4/1/1:A/1:C 7ve5/1/1:A/1:B
Other dimers with similar sequences but different poses	4if4/3/1:B/1:C 4if4/1/1:A/1:D 4if4/1/1:B/1:C 4if4/2/1:A/1:D 7ve6/1/1:A/1:B