4iim/1/1:B/1:A

Sequences
>4iim-a1-m1-cB (length=55) [Search sequence]
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLI
>4iim-a1-m1-cA (length=57) [Search sequence]
LLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISA
Structure information
PDB ID 4iim (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Second SH3 Domain of ITSN1 bound with a synthetic peptide
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q15811 Q15811
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4iimB BioLiP:4iimA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4iim-a1-m1-cB_4iim-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4iim-assembly1.cif.gz

[Back to Home]