4irr/1/1:A/1:B

Sequences

>4irr-a1-m1-cA (length=290) [Search sequence]

QQVHLNQDEYKYLKQVEQILREGTRRDDRTGTGTISIFGMQSKYCLRNGTIPLLTTKRVY
WKGVLEELLWFISGSTDGKLLMEKNVKIWEKNGDRAFLDNLGFTSREEGDLGPVYGFQWR
HFGAKYVDCHTDYSGQGVDQLAEVIRQIKEQPDSRRIIMSAWNPSDLGQMVLPPCHTMCQ
FYVDNGELSCQLYQRSGDMGLGVPFNLASYGLLTHMIAKVCGLKPGTLVHTLGDAHVYSN
HVDALKIQLDREPYAFPKIRFTRDVASIDDFTSDMIALDDYKCHPKIPMD

>4irr-a1-m1-cB (length=290) [Search sequence]

Structure information

PDB ID	4irr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of C.elegans Thymidylate Synthase in Complex with dUMP
Assembly ID	1
Resolution	2.48Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	124
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9Y052	Q9Y052
Species	6239 (Caenorhabditis elegans)	6239 (Caenorhabditis elegans)
Function annotation	BioLiP:4irrA	BioLiP:4irrB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4irr-a1-m1-cA_4irr-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4irr-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4iqb/1/1:A/1:B 4isw/1/1:A/1:B 4psg/1/1:A/1:B 5noo/1/1:A/1:B 5noo/2/1:C/1:D