4ive/3/1:C/1:D

Sequences
>4ive-a3-m1-cC (length=72) [Search sequence]
ETLTASRLASAPPQKQKQLGERLFPLIQAHPTLAGKITGLLEIDNSELLYLESPESLRSK
VDEAVAVLQAHQ
>4ive-a3-m1-cD (length=72) [Search sequence]
ETLTASRLASAPPQKQKQLGERLFPLIQAHPTLAGKITGLLEIDNSELLYLESPESLRSK
VDEAVAVLQAHQ
Structure information
PDB ID 4ive (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a polyadenylate-binding protein 3 (PABPC3) from Homo sapiens at 2.30 A resolution
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q9H361 Q9H361
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ive-a3-m1-cC_4ive-a3-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4ive-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4ive/1/1:A/1:B 4ive/1/1:C/1:D 4ive/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 4ive/1/1:A/1:D 4ive/1/1:C/1:B
  • [Back to Home]