4iyl/3/3:A/4:A

Sequences
>4iyl-a3-m3-cA (length=85) [Search sequence]
LDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQ
RKRLLSYLKRKDYNSYSKLITELNL
>4iyl-a3-m4-cA (length=85) [Search sequence]
LDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQ
RKRLLSYLKRKDYNSYSKLITELNL
Structure information
PDB ID 4iyl (database links: RCSB PDB PDBe PDBj PDBsum)
Title 30S ribosomal protein S15 from Campylobacter jejuni
Assembly ID 3
Resolution 2.36Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession Q0PA13 Q0PA13
Species 192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819) 192222 (Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4iyl-a3-m3-cA_4iyl-a3-m4-cA.pdb.gz
Full biological assembly
Download: 4iyl-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4iyl/2/1:A/2:A 4iyl/3/1:A/2:A
Other dimers with similar sequences but different poses
  • 4iyl/3/1:A/4:A 4iyl/3/2:A/3:A
  • [Back to Home]