4j2n/1/1:D/1:E

Sequences
>4j2n-a1-m1-cD (length=54) [Search sequence]
MPPRASIQQTADYLGVSTKTVRNYIAAGKLKAVRLGPRLIRVERDSVEALMRPI
>4j2n-a1-m1-cE (length=54) [Search sequence]
MPPRASIQQTADYLGVSTKTVRNYIAAGKLKAVRLGPRLIRVERDSVEALMRPI
Structure information
PDB ID 4j2n (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of mycobacteriophage Pukovnik Xis
Assembly ID 1
Resolution 2.348Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession B3VGI6 B3VGI6
Species 540068 (Pukovnikvirus pukovnik) 540068 (Pukovnikvirus pukovnik)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4j2n-a1-m1-cD_4j2n-a1-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4j2n-assembly1.cif.gz

[Back to Home]