4j30/1/1:B/2:B

Sequences

>4j30-a1-m1-cB (length=100) [Search sequence]

QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEI AKKYSGLKYNGSISSDFNTKCIDFIHDRELNELIKRRVEK

>4j30-a1-m2-cB (length=100) [Search sequence]

QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEI AKKYSGLKYNGSISSDFNTKCIDFIHDRELNELIKRRVEK

Structure information

PDB ID	4j30 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of the effector - immunity system Tae4 / Tai4 from Salmonella typhimurium, selenomethionine variant
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	94
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	B	B
UniProt accession	Q8ZRL5	Q8ZRL5
Species	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)	99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4j30-a1-m1-cB_4j30-a1-m2-cB.pdb.gz

Full biological assembly Download: 4j30-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4hff/2/1:B/2:B 4j32/1/1:B/2:B