4j3y/1/1:C/1:A

Sequences

>4j3y-a1-m1-cC (length=77) [Search sequence]

PAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAW SEHRRHFPNCFFVLGRN

>4j3y-a1-m1-cA (length=83) [Search sequence]

GTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNW EPGDRAWSEHRRHFPNCFFVLGR

Structure information

PDB ID	4j3y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of XIAP-BIR2 domain
Assembly ID	1
Resolution	1.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	0.987
PubMed citation	23999295

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	P98170	P98170
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4j3yC	BioLiP:4j3yA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4j3y-a1-m1-cC_4j3y-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4j3y-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4wvt/1/1:C/1:A 4wvt/2/1:D/1:B