4j8c/1/1:A/1:B

Sequences
>4j8c-a1-m1-cA (length=44) [Search sequence]
MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPP
>4j8c-a1-m1-cB (length=44) [Search sequence]
MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPP
Structure information
PDB ID 4j8c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the dimerization domain of Hsc70-interacting protein
Assembly ID 1
Resolution 1.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 48
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P50503 P50503
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4j8c-a1-m1-cA_4j8c-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4j8c-assembly1.cif.gz

[Back to Home]