4jcw/1/1:A/1:B

Sequences

>4jcw-a1-m1-cA (length=202) [Search sequence]

MTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTGPKGT
VRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKEGSSR
WWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYGRAVV
LPGLRMAPGEIQRTASRFYPVH

>4jcw-a1-m1-cB (length=202) [Search sequence]

Structure information

PDB ID	4jcw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Clavibacter michiganensis expansin in complex with cellopentaose
Assembly ID	1
Resolution	1.75Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	A5CLK3	A5CLK3
Species	443906 (Clavibacter michiganensis subsp. michiganensis NCPPB 382)	443906 (Clavibacter michiganensis subsp. michiganensis NCPPB 382)
Function annotation	BioLiP:4jcwA	BioLiP:4jcwB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4jcw-a1-m1-cA_4jcw-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4jcw-assembly1.cif.gz