4jcy/1/1:A/1:B

Sequences
>4jcy-a1-m1-cA (length=92) [Search sequence]
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP
VSYLYTPEDDLAQIILTWNELNEQERKRINFY
>4jcy-a1-m1-cB (length=92) [Search sequence]
MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP
VSYLYTPEDDLAQIILTWNELNEQERKRINFY
Structure information
PDB ID 4jcy (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Restriction-Modification Controller Protein C.Csp231I OR operator complex
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 65
Sequence identity between the two chains 1.0
PubMed citation 25664751
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q32WH4 Q32WH4
Species 315237 (Citrobacter sp. RFL231) 315237 (Citrobacter sp. RFL231)
Function annotation BioLiP:4jcyA BioLiP:4jcyB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4jcy-a1-m1-cA_4jcy-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4jcy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3lfp/1/1:A/2:A 3lis/1/1:A/1:B 4jcx/1/1:A/1:B 4jqd/1/1:A/1:B 4jqd/2/1:F/1:E

[Back to Home]