4jgj/1/1:B/1:A

Sequences

>4jgj-a1-m1-cB (length=104) [Search sequence]

ALLTSKEMRFSAAEGAKVLLSVPDLLSFSWYKGKDVNENFTIAHYKKSSDSLQLGKKVSG REEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHLQVYKI

>4jgj-a1-m1-cA (length=105) [Search sequence]

ALLTSKEMRFSAAEGAKVLLSVPDNLLSFSWYKGKDVNENFTIAHYKKSSDSLQLGKKVS GREEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHLQVYKI

Structure information

PDB ID	4jgj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Ig-like D1 domain from mouse Carcinoembryogenic antigen-related cell adhesion molecule 15 (CEACAM15) [PSI-NYSGRC-005691]
Assembly ID	1
Resolution	2.6508Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	A0A0B4J1L0	A0A0B4J1L0
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:4jgjB	BioLiP:4jgjA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4jgj-a1-m1-cB_4jgj-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4jgj-assembly1.cif.gz