4jgj/1/1:B/1:A

Sequences
>4jgj-a1-m1-cB (length=104) [Search sequence]
ALLTSKEMRFSAAEGAKVLLSVPDLLSFSWYKGKDVNENFTIAHYKKSSDSLQLGKKVSG
REEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHLQVYKI
>4jgj-a1-m1-cA (length=105) [Search sequence]
ALLTSKEMRFSAAEGAKVLLSVPDNLLSFSWYKGKDVNENFTIAHYKKSSDSLQLGKKVS
GREEIYKDGSMMLRAITLEDTGFYTLQTFKGQQEVTHVHLQVYKI
Structure information
PDB ID 4jgj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Ig-like D1 domain from mouse Carcinoembryogenic antigen-related cell adhesion molecule 15 (CEACAM15) [PSI-NYSGRC-005691]
Assembly ID 1
Resolution 2.6508Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession A0A0B4J1L0 A0A0B4J1L0
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:4jgjB BioLiP:4jgjA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4jgj-a1-m1-cB_4jgj-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4jgj-assembly1.cif.gz

[Back to Home]