4jjn/1/1:E/1:A

Sequences
>4jjn-a1-m1-cE (length=96) [Search sequence]
HRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEA
YLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGER
>4jjn-a1-m1-cA (length=98) [Search sequence]
PHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVE
AYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS
Structure information
PDB ID 4jjn (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of heterochromatin protein Sir3 in complex with a silenced yeast nucleosome
Assembly ID 1
Resolution 3.09Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation 23650358
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E A
UniProt accession P61830 P61830
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
Function annotation BioLiP:4jjnE BioLiP:4jjnA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4jjn-a1-m1-cE_4jjn-a1-m1-cA.pdb.gz
Full biological assembly
Download: 4jjn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1id3/1/1:A/1:E 4kud/1/1:A/1:E 6gej/1/1:A/1:B 6gen/1/1:A/1:B 7e9c/1/1:E/1:A 7e9f/1/1:E/1:A 7k7g/1/1:A/1:E 7wlr/1/1:A/1:E

[Back to Home]