4jol/2/1:B/1:D

Sequences
>4jol-a2-m1-cB (length=60) [Search sequence]
IDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE
>4jol-a2-m1-cD (length=60) [Search sequence]
IDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAE
Structure information
PDB ID 4jol (database links: RCSB PDB PDBe PDBj PDBsum)
Title Complex structure of AML1-ETO NHR2 domain with HEB fragment
Assembly ID 2
Resolution 2.906Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 55
Sequence identity between the two chains 1.0
PubMed citation 23812588
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession Q06455 Q06455
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4jolB BioLiP:4jolD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4jol-a2-m1-cB_4jol-a2-m1-cD.pdb.gz
Full biological assembly
Download: 4jol-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1wq6/1/1:A/2:A 1wq6/1/1:B/2:B 4jol/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 1wq6/1/2:A/2:B 1wq6/1/1:A/1:B
  • 1wq6/1/1:A/2:B 1wq6/1/1:B/2:A
  • [Back to Home]