4jpb/2/1:C/4:C

Sequences

>4jpb-a2-m1-cC (length=85) [Search sequence]

QIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNE TNEVTKQIVEKAREILESSQRSLEN

>4jpb-a2-m4-cC (length=85) [Search sequence]

QIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNE TNEVTKQIVEKAREILESSQRSLEN

Structure information

PDB ID	4jpb (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of a ternary complex between CheA domains P4 and P5 with CheW and with an unzipped fragment of TM14, a chemoreceptor analog from Thermotoga maritima.
Assembly ID	2
Resolution	3.186Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	123
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	4
Chain ID	C	C
UniProt accession	Q7DFA3	Q7DFA3
Species	243274 (Thermotoga maritima MSB8)	243274 (Thermotoga maritima MSB8)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4jpb-a2-m1-cC_4jpb-a2-m4-cC.pdb.gz

Full biological assembly Download: 4jpb-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

3g67/1/1:B/1:A 3g6b/1/1:B/1:A 3ur1/1/1:C/1:D 4jpb/2/4:B/4:C 4jpb/2/1:B/1:C 4jpb/2/1:B/4:C 4jpb/2/4:B/1:C