4jpb/2/4:B/4:C

Sequences
>4jpb-a2-m4-cB (length=84) [Search sequence]
QIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNE
TNEVTKQIVEKAREILESSQRSLE
>4jpb-a2-m4-cC (length=85) [Search sequence]
QIGETLENIRSIEKLIQNIMRIARETNILALNATIEAARAGEAGKGFMIVANEVQNLSNE
TNEVTKQIVEKAREILESSQRSLEN
Structure information
PDB ID 4jpb (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of a ternary complex between CheA domains P4 and P5 with CheW and with an unzipped fragment of TM14, a chemoreceptor analog from Thermotoga maritima.
Assembly ID 2
Resolution 3.186Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 116
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 4
Chain ID B C
UniProt accession Q7DFA3 Q7DFA3
Species 243274 (Thermotoga maritima MSB8) 243274 (Thermotoga maritima MSB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4jpb-a2-m4-cB_4jpb-a2-m4-cC.pdb.gz
Full biological assembly
Download: 4jpb-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3g67/1/1:B/1:A 3g6b/1/1:B/1:A 3ur1/1/1:C/1:D
  • 4jpb/2/1:C/4:C 4jpb/2/1:B/4:B
  • 4jpb/2/1:B/4:C 4jpb/2/4:B/1:C
  • [Back to Home]