4jyi/1/1:A/1:B

Sequences

>4jyi-a1-m1-cA (length=239) [Search sequence]

SYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCI
IKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQ
MHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLL
EALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMME

>4jyi-a1-m1-cB (length=239) [Search sequence]

Structure information

PDB ID	4jyi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of RARbeta LBD in complex with selective partial agonist BMS641 [3-chloro-4-[(E)-2-(5,5-dimethyl-8-phenyl-5,6-dihydronaphthalen-2-yl)ethenyl]benzoic acid]
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0
PubMed citation	25933005

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P10826	P10826
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4jyiA	BioLiP:4jyiB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4jyi-a1-m1-cA_4jyi-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4jyi-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4jyg/1/1:A/1:B 4jyh/1/1:A/1:B 6ssq/1/1:A/1:B