4k3h/3/1:F/1:E

Sequences
>4k3h-a3-m1-cF (length=109) [Search sequence]
QAVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWT
PGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVL
>4k3h-a3-m1-cE (length=109) [Search sequence]
QAVVTQEPSVTVSPGGTVILTCGSSTGAVTSGHYANWFQQKPGQAPRALIFETDKKYSWT
PGRFSGSLLGAKAALTISDAQPEDEAEYYCSLSDVDGYLFGGGTQLTVL
Structure information
PDB ID 4k3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Immunoglobulin lambda variable domain L5(L89S) fluorogen activationg protein in complex with malachite green
Assembly ID 3
Resolution 2.45Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
PubMed citation 23978698
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F E
UniProt accession
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4k3hF BioLiP:4k3hE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4k3h-a3-m1-cF_4k3h-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4k3h-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4k3g/1/1:B/1:A 4k3h/1/1:B/1:A 4k3h/2/1:D/1:C 4k3h/4/1:H/1:G

[Back to Home]