4kjm/2/1:B/2:B

Sequences
>4kjm-a2-m1-cB (length=117) [Search sequence]
TGNLQTAINDKSGTLASQNFLDADEQKRNAYNQAVSAAETILAKTAVEQALNNVNNAKHA
LNGTQNLNNAKQAAITAINGASDLNQKQKDALKAQANGAQRVSNAQDVQHNATELNT
>4kjm-a2-m2-cB (length=117) [Search sequence]
TGNLQTAINDKSGTLASQNFLDADEQKRNAYNQAVSAAETILAKTAVEQALNNVNNAKHA
LNGTQNLNNAKQAAITAINGASDLNQKQKDALKAQANGAQRVSNAQDVQHNATELNT
Structure information
PDB ID 4kjm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the Staphylococcus aureus protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q8NWQ6 Q8NWQ6
Species 196620 (Staphylococcus aureus subsp. aureus MW2) 196620 (Staphylococcus aureus subsp. aureus MW2)
Function annotation BioLiP:4kjmB BioLiP:4kjmB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4kjm-a2-m1-cB_4kjm-a2-m2-cB.pdb.gz
Full biological assembly
Download: 4kjm-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4kjm/2/2:B/2:A 4kjm/1/1:B/1:A 4kjm/2/1:B/1:A
  • 4kjm/2/2:B/1:A 4kjm/2/1:B/2:A
  • [Back to Home]