4kp4/1/1:B/1:A

Sequences

>4kp4-a1-m1-cB (length=217) [Search sequence]

ADDRTLLMAGVSHDLRTPLTRIRAYAETIYNSLGELDLSTLKELAESINKDIEECNAIIE
QFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVA
NMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGT
GLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVP

>4kp4-a1-m1-cA (length=219) [Search sequence]

Structure information

PDB ID	4kp4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Deciphering cis-trans directionality and visualizing autophosphorylation in histidine kinases.
Assembly ID	1
Resolution	3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0
PubMed citation	24500224

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P0AEJ4	P0AEJ4
Species	243274 (Thermotoga maritima MSB8)	243274 (Thermotoga maritima MSB8)
Function annotation	BioLiP:4kp4A

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4kp4-a1-m1-cB_4kp4-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4kp4-assembly1.cif.gz