4ksn/1/1:B/2:D

Sequences
>4ksn-a1-m1-cB (length=52) [Search sequence]
GQLDTHLADLYLLKYDTGLGVYESFICKYLEPRPLESETVSLRQLIVSVLPS
>4ksn-a1-m2-cD (length=61) [Search sequence]
GQLDTHLADLYLLKYDTGLGVYESFICKYLEDSNDYIEPRPLESETVSLRQLIVSVLPSR
P
Structure information
PDB ID 4ksn (database links: RCSB PDB PDBe PDBj PDBsum)
Title C-terminal domain of SdbC protein from Legionella pneumophila.
Assembly ID 1
Resolution 1.86Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B D
UniProt accession Q5ZSX5 Q5ZSX5
Species 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1) 272624 (Legionella pneumophila subsp. pneumophila str. Philadelphia 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4ksn-a1-m1-cB_4ksn-a1-m2-cD.pdb.gz
Full biological assembly
Download: 4ksn-assembly1.cif.gz

[Back to Home]