4l5n/5/1:D/1:C

Sequences
>4l5n-a5-m1-cD (length=49) [Search sequence]
LDSYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKI
>4l5n-a5-m1-cC (length=50) [Search sequence]
LDSYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKIS
Structure information
PDB ID 4l5n (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus phage PZA inhibitor protein p56
Assembly ID 5
Resolution 2.16Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P06948 P06948
Species 10757 (Bacillus phage PZA) 10757 (Bacillus phage PZA)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4l5n-a5-m1-cD_4l5n-a5-m1-cC.pdb.gz
Full biological assembly
Download: 4l5n-assembly5.cif.gz
Similar dimers

[Back to Home]