4l5n/6/1:E/1:F

Sequences

>4l5n-a6-m1-cE (length=47) [Search sequence]

SYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKI

>4l5n-a6-m1-cF (length=48) [Search sequence]

DSYDVTMLLQDDNGKQYYEYHKGLSLSDFEVLYGNTVDEIIKLRVDKI

Structure information

PDB ID	4l5n (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus phage PZA inhibitor protein p56
Assembly ID	6
Resolution	2.16Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	F
UniProt accession	P06948	P06948
Species	10757 (Bacillus phage PZA)	10757 (Bacillus phage PZA)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4l5n-a6-m1-cE_4l5n-a6-m1-cF.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4l5n-assembly6.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2le2/1/1:A/1:B 3zoq/1/1:B/1:C 4l5n/3/1:E/1:F