4lbf/1/1:A/1:B

Sequences
>4lbf-a1-m1-cA (length=30) [Search sequence]
ACYCRIPACIAGERRYGTCAYQGRAWAFCC
>4lbf-a1-m1-cB (length=30) [Search sequence]
ACYCRIPACIAGERRYGTCAYQGRAWAFCC
Structure information
PDB ID 4lbf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of HUMAN ALPHA-DEFENSIN 1 (HNP1) I20A/L25A mutant
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 14
Sequence identity between the two chains 1.0
PubMed citation 24236072
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P59665 P59665
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4lbfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4lbf-a1-m1-cA_4lbf-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4lbf-assembly1.cif.gz

[Back to Home]