4lbf/2/1:E/1:H

Sequences

>4lbf-a2-m1-cE (length=25) [Search sequence]

ACYCRIPACIAGERRYGTCAWAFCC

>4lbf-a2-m1-cH (length=30) [Search sequence]

ACYCRIPACIAGERRYGTCAYQGRAWAFCC

Structure information

PDB ID	4lbf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of HUMAN ALPHA-DEFENSIN 1 (HNP1) I20A/L25A mutant
Assembly ID	2
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0
PubMed citation	24236072

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	P59665	P59665
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4lbfH

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4lbf-a2-m1-cE_4lbf-a2-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4lbf-assembly2.cif.gz