4le9/1/1:A/2:A

Sequences

>4le9-a1-m1-cA (length=59) [Search sequence]

HMTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGRTGYIPSNYVAPSD

>4le9-a1-m2-cA (length=59) [Search sequence]

HMTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGRTGYIPSNYVAPSD

Structure information

PDB ID	4le9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a chimeric c-Src-SH3 domain
Assembly ID	1
Resolution	1.344Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	216
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	P00523	P00523
Species	9031 (Gallus gallus)	9031 (Gallus gallus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4le9-a1-m1-cA_4le9-a1-m2-cA.pdb.gz

Full biological assembly Download: 4le9-assembly1.cif.gz

Similar dimers