4lh9/1/1:A/6:A

Sequences
>4lh9-a1-m1-cA (length=40) [Search sequence]
DVPPERWDEAMQELDEIIRTWADKYHQVGGIPMILQMVFG
>4lh9-a1-m6-cA (length=40) [Search sequence]
DVPPERWDEAMQELDEIIRTWADKYHQVGGIPMILQMVFG
Structure information
PDB ID 4lh9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the refolded hood domain (Asp256-Gly295) of HetR
Assembly ID 1
Resolution 2.049Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 6
Chain ID A A
UniProt accession P27709 P27709
Species 103690 (Nostoc sp. PCC 7120 = FACHB-418) 103690 (Nostoc sp. PCC 7120 = FACHB-418)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4lh9-a1-m1-cA_4lh9-a1-m6-cA.pdb.gz
Full biological assembly
Download: 4lh9-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4lh9/1/2:A/5:A 4lh9/1/3:A/4:A
Other dimers with similar sequences but different poses
  • 4yrv/1/1:B/1:A 4hri/1/1:A/1:B 4ynl/1/1:B/1:A 4ynl/2/1:N/1:M
  • 4lh9/1/3:A/6:A 4lh9/1/1:A/5:A 4lh9/1/2:A/4:A
  • [Back to Home]