4lhx/2/1:D/1:C

Sequences
>4lhx-a2-m1-cD (length=71) [Search sequence]
GYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQA
TAEKQLKEAQG
>4lhx-a2-m1-cC (length=72) [Search sequence]
GYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQA
TAEKQLKEAQGK
Structure information
PDB ID 4lhx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of nucleotide-free Rab8:Rabin8
Assembly ID 2
Resolution 3.05Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 111
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q96QF0 Q96QF0
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4lhx-a2-m1-cD_4lhx-a2-m1-cC.pdb.gz
Full biological assembly
Download: 4lhx-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4lhx/1/1:E/1:F 4lhy/1/1:E/1:F 4lhy/2/1:D/1:C 4lhz/1/1:E/1:F 4lhz/2/1:D/1:C
Other dimers with similar sequences but different poses
  • 6f6p/1/1:C/1:D 6f6p/1/1:B/1:A
  • 6f6p/1/1:B/1:D 6f6p/1/1:C/1:A
  • [Back to Home]