4lj0/1/1:B/1:A

Sequences

>4lj0-a1-m1-cB (length=64) [Search sequence]

EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPCTNRSCPFLHE EGQR

>4lj0-a1-m1-cA (length=65) [Search sequence]

EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPCTNRSCPFLHE EGQRG

Structure information

PDB ID	4lj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Nab2 Zn fingers complexed with polyadenosine
Assembly ID	1
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	24071581

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	G0SCL7	G0SCL7
Species	759272 (Thermochaetoides thermophila DSM 1495)	759272 (Thermochaetoides thermophila DSM 1495)
Function annotation	BioLiP:4lj0B	BioLiP:4lj0A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4lj0-a1-m1-cB_4lj0-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4lj0-assembly1.cif.gz