4lj0/1/1:B/1:A

Sequences
>4lj0-a1-m1-cB (length=64) [Search sequence]
EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPCTNRSCPFLHE
EGQR
>4lj0-a1-m1-cA (length=65) [Search sequence]
EQDCKYWPNCANPLCAFRHPTMPPCRNGGECKVPGCKFTHLKTPCKFRPCTNRSCPFLHE
EGQRG
Structure information
PDB ID 4lj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Nab2 Zn fingers complexed with polyadenosine
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 24071581
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession G0SCL7 G0SCL7
Species 759272 (Thermochaetoides thermophila DSM 1495) 759272 (Thermochaetoides thermophila DSM 1495)
Function annotation BioLiP:4lj0B BioLiP:4lj0A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4lj0-a1-m1-cB_4lj0-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4lj0-assembly1.cif.gz

[Back to Home]