4lpa/5/1:A/2:D

Sequences
>4lpa-a5-m1-cA (length=112) [Search sequence]
AFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTL
RILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAAIPIPT
>4lpa-a5-m2-cD (length=112) [Search sequence]
AFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTL
RILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAAIPIPT
Structure information
PDB ID 4lpa (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a Cdc6 phosphopeptide in complex with Cks1
Assembly ID 5
Resolution 2.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A D
UniProt accession P20486 P20486
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4lpa-a5-m1-cA_4lpa-a5-m2-cD.pdb.gz
Full biological assembly
Download: 4lpa-assembly5.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1qb3/5/1:B/3:B 1qb3/3/1:B/3:B 1qb3/3/4:B/5:B 1qb3/4/1:C/1:A
  • 3qy2/4/1:B/2:B 3qy2/3/1:B/2:B
  • 4lpa/5/1:B/2:D 4lpa/5/1:A/2:C
    		•

    [Back to Home]