4lqf/1/1:A/2:A

Sequences
>4lqf-a1-m1-cA (length=78) [Search sequence]
SCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNP
ITSDVSQEVRKYFCVKTM
>4lqf-a1-m2-cA (length=78) [Search sequence]
SCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNP
ITSDVSQEVRKYFCVKTM
Structure information
PDB ID 4lqf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of murine IgG2b A2C7-Fab in complex with vaccinia antigen A33R at the resolution of 2.3 Angstroms
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
PubMed citation 26325270
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q71TT1 Q71TT1
Species 10245 (Vaccinia virus) 10245 (Vaccinia virus)
Function annotation BioLiP:4lqfA BioLiP:4lqfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4lqf-a1-m1-cA_4lqf-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4lqf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4lu5/1/1:B/1:A 4m1g/1/1:B/1:A

[Back to Home]