4lqf/1/1:A/2:A

Sequences

>4lqf-a1-m1-cA (length=78) [Search sequence]

SCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNP ITSDVSQEVRKYFCVKTM

>4lqf-a1-m2-cA (length=78) [Search sequence]

SCNGLYYQGSCYILHSDYQMFSDAAANCTAESSTLPNKSDVMITWLIDYVEDTWGSDGNP ITSDVSQEVRKYFCVKTM

Structure information

PDB ID	4lqf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of murine IgG2b A2C7-Fab in complex with vaccinia antigen A33R at the resolution of 2.3 Angstroms
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	19
Sequence identity between the two chains	1.0
PubMed citation	26325270

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q71TT1	Q71TT1
Species	10245 (Vaccinia virus)	10245 (Vaccinia virus)
Function annotation	BioLiP:4lqfA	BioLiP:4lqfA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4lqf-a1-m1-cA_4lqf-a1-m2-cA.pdb.gz

Full biological assembly Download: 4lqf-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4lu5/1/1:B/1:A 4m1g/1/1:B/1:A