4lwd/2/1:A/6:A

Sequences
>4lwd-a2-m1-cA (length=90) [Search sequence]
ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDIL
HTKGQRGYVVFLESLEFYYPELYKLVTGKE
>4lwd-a2-m6-cA (length=90) [Search sequence]
ALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLNAPMLPSKINRAGRLLDIL
HTKGQRGYVVFLESLEFYYPELYKLVTGKE
Structure information
PDB ID 4lwd (database links: RCSB PDB PDBe PDBj PDBsum)
Title Human CARMA1 CARD domain
Assembly ID 2
Resolution 1.792Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 6
Chain ID A A
UniProt accession Q9BXL7 Q9BXL7
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4lwd-a2-m1-cA_4lwd-a2-m6-cA.pdb.gz
Full biological assembly
Download: 4lwd-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4lwd/2/2:A/5:A 4lwd/2/3:A/4:A
Other dimers with similar sequences but different poses
  • 4lwd/2/5:A/6:A 4lwd/2/1:A/2:A 4lwd/2/1:A/3:A 4lwd/2/2:A/3:A 4lwd/2/4:A/5:A 4lwd/2/4:A/6:A
  • [Back to Home]