4m1p/1/3:A/4:A

Sequences
>4m1p-a1-m3-cA (length=96) [Search sequence]
VLHGTMIPRTKEEIENIMKRLKRIEGQVRGVQKMVEDNRYCIDILVQISAIQAALRQVGM
QLLERHANHCVAKAIREGSGEQSLRELMDVIKQFAK
>4m1p-a1-m4-cA (length=96) [Search sequence]
VLHGTMIPRTKEEIENIMKRLKRIEGQVRGVQKMVEDNRYCIDILVQISAIQAALRQVGM
QLLERHANHCVAKAIREGSGEQSLRELMDVIKQFAK
Structure information
PDB ID 4m1p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the copper-sensing repressor CsoR with Cu(I) from Geobacillus thermodenitrificans NG80-2
Assembly ID 1
Resolution 2.564Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 116
Sequence identity between the two chains 1.0
PubMed citation 24831014
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession A4INJ9 A4INJ9
Species 420246 (Geobacillus thermodenitrificans NG80-2) 420246 (Geobacillus thermodenitrificans NG80-2)
Function annotation BioLiP:4m1pA BioLiP:4m1pA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4m1p-a1-m3-cA_4m1p-a1-m4-cA.pdb.gz
Full biological assembly
Download: 4m1p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4m1p/2/12:A/9:A 4m1p/1/1:A/3:A 4m1p/1/2:A/4:A 4m1p/2/10:A/6:A 4m1p/2/11:A/5:A 4m1p/2/13:A/8:A 4m1p/2/14:A/7:A 4m1p/2/1:A/3:A
  • [Back to Home]