4m3l/1/1:D/1:C

Sequences
>4m3l-a1-m1-cD (length=53) [Search sequence]
TLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSL
>4m3l-a1-m1-cC (length=57) [Search sequence]
AMDTLYAILDEKKSELLQRITQEQEEKLSFIEALIQQYQEQLDKSTKLVETAIQSLD
Structure information
PDB ID 4m3l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the coiled coil domain of MuRF1
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 19
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession Q969Q1 Q969Q1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4m3l-a1-m1-cD_4m3l-a1-m1-cC.pdb.gz
Full biological assembly
Download: 4m3l-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4m3l/1/1:D/1:B 4m3l/1/1:C/1:A
  • 4m3l/1/1:D/1:A 4m3l/1/1:C/1:B
    		•

    [Back to Home]