4m5t/3/1:C/1:E

Sequences
>4m5t-a3-m1-cC (length=85) [Search sequence]
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQEHGFISRCFHRKYRIPAD
VDPLTITSSLSSDGVLTVNGPRKQV
>4m5t-a3-m1-cE (length=85) [Search sequence]
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISRCFHRKYRIPA
DVDPLTITSSLSSDGVLTVNGPRKQ
Structure information
PDB ID 4m5t (database links: RCSB PDB PDBe PDBj PDBsum)
Title Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
Assembly ID 3
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 0.988
PubMed citation 24711386
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C E
UniProt accession P02511 P02511
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4m5tC BioLiP:4m5tE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4m5t-a3-m1-cC_4m5t-a3-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4m5t-assembly3.cif.gz

[Back to Home]