4m6r/1/1:B/1:C

Sequences

>4m6r-a1-m1-cB (length=224) [Search sequence]

MDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVCDI
NEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQ
EMIKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVY
VWGETWEKAKTMCECYDYLFDIAVSMKKVGLDPSQLPVGENGIV

>4m6r-a1-m1-cC (length=224) [Search sequence]

Structure information

PDB ID	4m6r (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme
Assembly ID	1
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	86
Sequence identity between the two chains	1.0
PubMed citation	24367089

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	Q96GX9	Q96GX9
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4m6rB	BioLiP:4m6rC

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4m6r-a1-m1-cB_4m6r-a1-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4m6r-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4m6r/1/1:A/1:B 4m6r/1/1:D/1:A 4m6r/1/1:D/1:C