4m8a/1/2:A/2:B

Sequences
>4m8a-a1-m2-cA (length=67) [Search sequence]
SKLSYTSFVQMVEDERSVVSEVVIRDDGVLRVYTKDGRVYEVDAPWAVNDSQLIEKLVSK
GIKVSGE
>4m8a-a1-m2-cB (length=68) [Search sequence]
SKLSYTSFVQMVEDERSVVSEVVIRDDGVLRVYTKDGRVYEVDAPWAVNDSQLIEKLVSK
GIKVSGER
Structure information
PDB ID 4m8a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Thermotoga maritima FtsH Periplasmic Domain
Assembly ID 1
Resolution 1.502Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q9WZ49 Q9WZ49
Species 243274 (Thermotoga maritima MSB8) 243274 (Thermotoga maritima MSB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4m8a-a1-m2-cA_4m8a-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4m8a-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4m8a/1/1:A/1:B 4m8a/1/1:B/1:C 4m8a/1/2:B/2:C 4q0f/1/1:B/1:A 4q0f/1/1:C/1:A 4q0f/1/2:B/2:A 4q0f/1/2:C/2:A

[Back to Home]