4m9v/3/1:C/1:F

Sequences
>4m9v-a3-m1-cC (length=60) [Search sequence]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
>4m9v-a3-m1-cF (length=60) [Search sequence]
PSERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSQVNRHLKVHQNKP
Structure information
PDB ID 4m9v (database links: RCSB PDB PDBe PDBj PDBsum)
Title Zfp57 mutant (E182Q) in complex with 5-carboxylcytosine DNA
Assembly ID 3
Resolution 0.969Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
PubMed citation 24236546
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C F
UniProt accession Q8C6P8 Q8C6P8
Species 10090 (Mus musculus) 10090 (Mus musculus)
Function annotation BioLiP:4m9vC BioLiP:4m9vF
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4m9v-a3-m1-cC_4m9v-a3-m1-cF.pdb.gz
Full biological assembly
Download: 4m9v-assembly3.cif.gz

[Back to Home]