4mbq/2/1:F/1:D

Sequences
>4mbq-a2-m1-cF (length=50) [Search sequence]
GADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERL
>4mbq-a2-m1-cD (length=51) [Search sequence]
GADEAATKLDLARAYIDMGDSEGARDILDEVLAEGNDSQQAEARELLERLA
Structure information
PDB ID 4mbq (database links: RCSB PDB PDBe PDBj PDBsum)
Title TPR3 of FimV from P. aeruginosa (PAO1)
Assembly ID 2
Resolution 2.006Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F D
UniProt accession Q9HZA6 Q9HZA6
Species 208964 (Pseudomonas aeruginosa PAO1) 208964 (Pseudomonas aeruginosa PAO1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4mbq-a2-m1-cF_4mbq-a2-m1-cD.pdb.gz
Full biological assembly
Download: 4mbq-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4mbq/2/1:C/1:D 4mbq/1/1:A/1:B
  • [Back to Home]