4mge/4/4:B/1:A

Sequences

>4mge-a4-m4-cB (length=107) [Search sequence]

MNILLCCSAGMSTSLLVTKMEAAAKARGLEGKIWAVSGDAVKTNIDQADVLLLGPQVRYM LSSMKTLADERNVGIDVINPMHYGMMNGEAVLDHALTLKKGENLYFQ

>4mge-a4-m1-cA (length=108) [Search sequence]

MNILLCCSAGMSTSLLVTKMEAAAKARGLEGKIWAVSGDAVKTNIDQADVLLLGPQVRYM LSSMKTLADERNVGIDVINPMHYGMMNGEAVLDHALTLKKGENLYFQS

Structure information

PDB ID	4mge (database links: RCSB PDB PDBe PDBj PDBsum)
Title	1.85 Angstrom Resolution Crystal Structure of PTS System Cellobiose-specific Transporter Subunit IIB from Bacillus anthracis.
Assembly ID	4
Resolution	1.85Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	33
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	1
Chain ID	B	A
UniProt accession	A0A6H3A658	A0A6H3A658
Species	261594 (Bacillus anthracis str. 'Ames Ancestor')	261594 (Bacillus anthracis str. 'Ames Ancestor')

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4mge-a4-m4-cB_4mge-a4-m1-cA.pdb.gz

Full biological assembly Download: 4mge-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4mge/4/4:B/3:A 4mge/3/2:B/1:A 4mge/4/2:B/1:A