4mod/2/4:B/5:B

Sequences
>4mod-a2-m4-cB (length=76) [Search sequence]
NQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLASEQINTTLLDLTYEM
LSLQQVVKALNESYID
>4mod-a2-m5-cB (length=76) [Search sequence]
NQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLASEQINTTLLDLTYEM
LSLQQVVKALNESYID
Structure information
PDB ID 4mod (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the MERS-CoV fusion core
Assembly ID 2
Resolution 1.901Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 88
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 5
Chain ID B B
UniProt accession K9N5Q8 K9N5Q8
Species 1235996 (Human betacoronavirus 2c EMC/2012) 1235996 (Human betacoronavirus 2c EMC/2012)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4mod-a2-m4-cB_4mod-a2-m5-cB.pdb.gz
Full biological assembly
Download: 4mod-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4mod/1/1:A/2:A 4mod/1/1:A/3:A 4mod/1/2:A/3:A 4mod/2/1:B/4:B 4mod/2/1:B/5:B

[Back to Home]