4n1j/3/2:C/2:D

Sequences

>4n1j-a3-m2-cC (length=86) [Search sequence]

SFFPDFGLLLYLEELNKEELNTFKLFLKETEPEHGLTPWNEVKKARREDLANLKKYYPGE KAWSVSLKIFGKNLKDLCERAKEEIN

>4n1j-a3-m2-cD (length=91) [Search sequence]

SSSFFPDFGLLLYLEELNKEELNTFKLFLKETEPEHGLTPWNEVKKARREDLANLKKYYP GEKAWSVSLKIFGKNLKDLCERAKEEINWSA

Structure information

PDB ID	4n1j (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structures of NLRP14 pyrin domain reveal a conformational switch mechanism, regulating its molecular interactions
Assembly ID	3
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	46
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	D
UniProt accession	Q86W24	Q86W24
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4n1j-a3-m2-cC_4n1j-a3-m2-cD.pdb.gz

Full biological assembly Download: 4n1j-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4n1j/1/1:A/1:B 4n1j/2/1:C/1:D 4n1j/3/1:A/1:B 4n1k/2/1:C/1:D 4n1k/3/2:C/2:D
Other dimers with similar sequences but different poses	4n1k/3/1:A/2:D 4n1k/3/2:C/1:B