4nbu/1/1:A/1:D

Sequences

>4nbu-a1-m1-cA (length=242) [Search sequence]

SRLQDKVAIITGAANGIGLEAARVFMKEGAKVVIADFNEAAGKEAVEANPGVVFIRVDVS
DRESVHRLVENVAERFGKIDILINNAGITRDSMLSKMTVDQFQQVINVNLTGVFHCTQAV
LPYMAEQGKGKIINTSSVTGTYGNVGQTNYAAAKAGVIGMTKTWAKELARKGINVNAVAP
GFTETAMVAEVPEKVIEKMKAQVPMGRLGKPEDIANAYLFLASHESDYVNGHVLHVDGGI
MM

>4nbu-a1-m1-cD (length=242) [Search sequence]

Structure information

PDB ID	4nbu (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of FabG from Bacillus sp
Assembly ID	1
Resolution	1.34Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	98
Sequence identity between the two chains	1.0
PubMed citation	24212572

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	D
UniProt accession	A6CQL2	A6CQL2
Species	161544 (Bacillus sp. SG-1)	161544 (Bacillus sp. SG-1)
Function annotation	BioLiP:4nbuA	BioLiP:4nbuD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4nbu-a1-m1-cA_4nbu-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4nbu-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

4nbu/1/1:D/1:B 4nbu/1/1:A/1:C