4ndy/4/1:B/1:X

Sequences

>4ndy-a4-m1-cB (length=74) [Search sequence]

SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDV DQLEKVLPQLLLDF

>4ndy-a4-m1-cX (length=74) [Search sequence]

SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDV DQLEKVLPQLLLDF

Structure information

PDB ID	4ndy (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Human MHF1-MHF2 DNA complex
Assembly ID	4
Resolution	6.999Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	X
UniProt accession	A8MT69	A8MT69
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4ndy-a4-m1-cB_4ndy-a4-m1-cX.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4ndy-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4ndy/2/1:L/1:U 4ne1/1/1:B/1:X 4ne1/1/1:V/1:W 4ne1/2/1:d/1:r 4ne1/2/1:h/1:o 4ne1/2/1:p/1:q
Other dimers with similar sequences but different poses	4ne1/1/1:D/1:H 4ndy/5/1:D/1:H