4niz/1/1:A/1:B

Sequences
>4niz-a1-m1-cA (length=29) [Search sequence]
RMKQLEDKEELLSKNYHLENEVARLKKLV
>4niz-a1-m1-cB (length=31) [Search sequence]
RMKQLEDKEELLSKNYHLENEVARLKKLVGE
Structure information
PDB ID 4niz (database links: RCSB PDB PDBe PDBj PDBsum)
Title GCN4-p1 single Val9 to aminobutyric acid mutant
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4niz-a1-m1-cA_4niz-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4niz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4nj2/1/1:A/1:B 4tl1/1/1:B/1:A 6o2f/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 2dgc/1/1:A/2:A 1dgc/1/1:A/2:A 1ysa/1/1:C/1:D 2o7h/1/1:B/1:C 2wpy/1/2:A/3:A
  • 2o7h/2/1:E/1:F 1rb5/1/1:A/1:B 1rb6/1/1:B/1:A 2o7h/1/1:B/1:A 2o7h/2/1:E/1:D 2o7h/2/1:F/1:D
  • 1rb6/1/1:C/1:A 1rb5/1/1:C/1:A
  • [Back to Home]