4nwo/1/5:B/9:B

Sequences

>4nwo-a1-m5-cB (length=114) [Search sequence]

MVRGIRGAITVNSDTPTSIIIATILLLEKMLEANGIQSYEELAAVIFTVTEDLTSAFPAE AARQIGMHRVPLLSAREVPVPGSLPRVIRVLALWNTDTPQDRVRHVYLSEAVRL

>4nwo-a1-m9-cB (length=114) [Search sequence]

MVRGIRGAITVNSDTPTSIIIATILLLEKMLEANGIQSYEELAAVIFTVTEDLTSAFPAE AARQIGMHRVPLLSAREVPVPGSLPRVIRVLALWNTDTPQDRVRHVYLSEAVRL

Structure information

PDB ID	4nwo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Computationally Designed Two-Component Self-Assembling Tetrahedral Cage T33-15
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	66
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	5	9
Chain ID	B	B
UniProt accession	Q5SJY4	Q5SJY4
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4nwo-a1-m5-cB_4nwo-a1-m9-cB.pdb.gz

Full biological assembly Download: 4nwo-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1ode/1/1:B/1:A 1ode/1/1:B/1:C 1ode/1/1:C/1:A 1ufy/1/1:A/2:A 1ufy/1/1:A/3:A 1ufy/1/2:A/3:A 1ui9/1/1:A/2:A 1ui9/1/1:A/3:A 1ui9/1/2:A/3:A 4nwo/1/10:B/5:B 4nwo/1/10:B/9:B 4nwo/1/11:B/3:B 4nwo/1/11:B/4:B 4nwo/1/12:B/2:B 4nwo/1/12:B/7:B 4nwo/1/1:B/6:B 4nwo/1/1:B/8:B 4nwo/1/2:B/7:B 4nwo/1/3:B/4:B 4nwo/1/6:B/8:B 4zk7/1/1:A/1:B 4zk7/1/1:A/1:D 4zk7/1/1:B/1:D 4zk7/1/1:C/1:E 4zk7/1/1:C/1:F 4zk7/1/1:E/1:F 4zk7/1/1:G/1:H 4zk7/1/1:G/1:I 4zk7/1/1:H/1:I 4zk7/1/1:J/1:K 4zk7/1/1:J/1:L 4zk7/1/1:K/1:L 7l85/1/1:B/1:O 7l85/1/1:B/1:S 7l85/1/1:C/1:I 7l85/1/1:C/1:K 7l85/1/1:E/1:G 7l85/1/1:E/1:X 7l85/1/1:G/1:X 7l85/1/1:I/1:K 7l85/1/1:M/1:Q 7l85/1/1:M/1:V 7l85/1/1:O/1:S 7l85/1/1:Q/1:V