4nxf/1/1:B/1:A

Sequences
>4nxf-a1-m1-cB (length=103) [Search sequence]
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRD
QRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDG
>4nxf-a1-m1-cA (length=105) [Search sequence]
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRD
QRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDGSD
Structure information
PDB ID 4nxf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of iLOV-I486(2LT) at pH 8.0
Assembly ID 1
Resolution 1.766Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
PubMed citation 25197956
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P93025 P93025
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:4nxfB BioLiP:4nxfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4nxf-a1-m1-cB_4nxf-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4nxf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4nxb/1/1:B/1:A 4nxe/1/1:A/1:B 4nxg/1/1:A/1:B

[Back to Home]