4nzg/2/1:A/1:C

Sequences
>4nzg-a2-m1-cA (length=93) [Search sequence]
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKAL
LERSHSPYYMLNRDRTLKNITETCKACAQVNAS
>4nzg-a2-m1-cC (length=93) [Search sequence]
HFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKMKAL
LERSHSPYYMLNRDRTLKNITETCKACAQVNAS
Structure information
PDB ID 4nzg (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the N-terminal domain of Moloney murine leukemia virus integrase, Northeast Structural Genomics Consortium Target OR3
Assembly ID 2
Resolution 2.152Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 28066922
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession P03355 P03355
Species 928306 (Moloney murine leukemia virus isolate Shinnick) 928306 (Moloney murine leukemia virus isolate Shinnick)
Function annotation BioLiP:4nzgA BioLiP:4nzgC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4nzg-a2-m1-cA_4nzg-a2-m1-cC.pdb.gz
Full biological assembly
Download: 4nzg-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3nnq/1/2:A/2:B 3nnq/1/1:A/1:B 4nzg/1/1:A/1:B 4nzg/1/1:C/1:D
  • 3nnq/1/1:A/2:B 3nnq/1/1:B/2:A 4nzg/1/1:A/1:D 4nzg/1/1:B/1:C
  • [Back to Home]